- Recombinant Mouse Cytochrome c oxidase subunit 8C, mitochondrial (Cox8c)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1089013
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 8,009 Da
- E Coli or Yeast
- 30-72
- cytochrome c oxidase subunit VIIIc
- COX8-3, COXVIII-3, 1700007F21Rik
- Cytochrome c oxidase subunit 8C, mitochondrial (Cox8c)
Sequence
HSESPQKKILSPTESAVGIVVFFTTFYIPAAYVLSSLKYFKGE